PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009611633.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 758aa    MW: 83273.7 Da    PI: 5.7733
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009611633.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox665e-2190145156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     r++ +++t++q++eLe++F+++++p+ ++r+eL+++lgL+  q+k+WFqN+R+++k
  XP_009611633.1  90 RKRYHRHTQHQIQELEAYFKECPHPDDKQRKELSRELGLEPLQIKFWFQNKRTQMK 145
                     789999***********************************************999 PP

2START205.71.9e-642784981206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela +a++e+v++a  +ep+W+ s     + +n++e+ ++f+++ +     +++ea+r++++v+m++++lve+l+d++  W+ ++     +a+t+
  XP_009611633.1 278 ELAVAAMEEFVQLAHMQEPLWFPSIengtSLLNEEEYFRIFPRGIGpkpdgFKTEASRETAIVIMNHVNLVEILMDVN-HWSSMFSgvvsRASTI 371
                     57899********************999999************999********************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     +v+s+g      galq++ ae+q++sp vp R+ +f+Ry++   +g+w++vdvS+d+ +  p    ++R++++pSg+li++++ng+skvtwveh+
  XP_009611633.1 372 DVLSTGvagnfnGALQVILAEFQVPSPQVPtRECYFARYCKHRVDGTWAVVDVSLDHLRAIP----SARCRRRPSGCLIQEMPNGYSKVTWVEHI 462
                     ************************************************************99....5**************************** PP

                     E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     +++++ +h+++++lv+sgla+gak+w+atl+rqce+
  XP_009611633.1 463 EVDDSAVHNIYKPLVSSGLAFGAKRWTATLDRQCER 498
                     **********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-2269145IPR009057Homeodomain-like
SuperFamilySSF466896.27E-2078148IPR009057Homeodomain-like
PROSITE profilePS5007117.32987147IPR001356Homeobox domain
SMARTSM003893.0E-2088151IPR001356Homeobox domain
CDDcd000867.82E-2089148No hitNo description
PfamPF000461.4E-1890145IPR001356Homeobox domain
PROSITE patternPS000270122145IPR017970Homeobox, conserved site
PROSITE profilePS5084842.344269501IPR002913START domain
SuperFamilySSF559611.1E-33271500No hitNo description
CDDcd088752.45E-123273497No hitNo description
SMARTSM002342.2E-62278498IPR002913START domain
PfamPF018524.3E-54279498IPR002913START domain
Gene3DG3DSA:3.30.530.201.8E-6374486IPR023393START-like domain
SuperFamilySSF559618.13E-26521748No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 758 aa     Download sequence    Send to blast
MPSRISRRAN KMSSLVVNDG TDIGFSSSGL PLGQSSSMMD SQLHSLDMLS NTSESEMPRL  60
SSEDFGSKSG NEGNSAGDEQ DVNNKSLNKR KRYHRHTQHQ IQELEAYFKE CPHPDDKQRK  120
ELSRELGLEP LQIKFWFQNK RTQMKTKNER SENSQLRAEN EKLRAENLRF REALGNVSCP  180
NCGGQQPPIG EMSYDEHHLR LENTRLREEI ERISTIASKY VGKPFSNHNN GYSPPLDLGV  240
PAFSTPQSVN GDAYGDGEDV IMSSLIGPSD TEKPFIIELA VAAMEEFVQL AHMQEPLWFP  300
SIENGTSLLN EEEYFRIFPR GIGPKPDGFK TEASRETAIV IMNHVNLVEI LMDVNHWSSM  360
FSGVVSRAST IDVLSTGVAG NFNGALQVIL AEFQVPSPQV PTRECYFARY CKHRVDGTWA  420
VVDVSLDHLR AIPSARCRRR PSGCLIQEMP NGYSKVTWVE HIEVDDSAVH NIYKPLVSSG  480
LAFGAKRWTA TLDRQCERLA SAMATNFPTN DLGNIVLTNQ DSRKSMLKLA ERMVNSFCSG  540
MSATAGNQWS TLSGSGSDDN VRVMTRKSVD DPGRPPGIVL SAATSFWLPI SPKRVFDFLR  600
DENTRSEWDI LSNGGVVQEM AHIANGRETG NCVSLLRVNS SNSSQSNMLI LQESSTDPTN  660
SYVVYAPVDI GAMNIVLGGG DPDFVALLPS GFAILPDGPP GNSRVGCGGS LLTVAFQILV  720
DSIPTAKLSL GSVATVNNLI ACTVDRIKAS LLSESTPS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009611633.10.0PREDICTED: homeobox-leucine zipper protein HDG2-like isoform X1
RefseqXP_009611623.10.0PREDICTED: homeobox-leucine zipper protein HDG2-like isoform X1
SwissprotQ94C370.0HDG2_ARATH; Homeobox-leucine zipper protein HDG2
TrEMBLD7TEM30.0D7TEM3_VITVI; Putative uncharacterized protein
STRINGVIT_12s0059g02310.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2